6m8s/1/1:B/1:O

Sequences

>6m8s-a1-m1-cB (length=101) [Search sequence]

RSGYITIGYRGSYTIDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYY LKFNFLEQAFDKLSESGFHMVACSSTGTCIWTSYTEYVFCR

>6m8s-a1-m1-cO (length=105) [Search sequence]

RSGYITIGYRGSYTIDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYY LKFNFLEQAFDKLSESGFHMVACSSTGTCSEDKIWTSYTEYVFCR

Structure information

PDB ID	6m8s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the KCTD12 H1 domain in complex with Gbeta1gamma2 subunits
Assembly ID	1
Resolution	3.71Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	89
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	O
UniProt accession	Q96CX2	Q96CX2
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6m8s-a1-m1-cB_6m8s-a1-m1-cO.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6m8s-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6m8s/1/1:A/1:M 6m8s/1/1:B/1:M 6m8s/1/1:P/1:O 6qzl/1/1:B/1:C 6qzl/1/1:D/1:C 6qzl/1/1:E/1:A