6m8s/1/1:B/1:O

Sequences
>6m8s-a1-m1-cB (length=101) [Search sequence]
RSGYITIGYRGSYTIDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYY
LKFNFLEQAFDKLSESGFHMVACSSTGTCIWTSYTEYVFCR
>6m8s-a1-m1-cO (length=105) [Search sequence]
RSGYITIGYRGSYTIDAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYY
LKFNFLEQAFDKLSESGFHMVACSSTGTCSEDKIWTSYTEYVFCR
Structure information
PDB ID 6m8s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the KCTD12 H1 domain in complex with Gbeta1gamma2 subunits
Assembly ID 1
Resolution 3.71Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 89
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B O
UniProt accession Q96CX2 Q96CX2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6m8s-a1-m1-cB_6m8s-a1-m1-cO.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6m8s-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6m8s/1/1:A/1:M 6m8s/1/1:B/1:M 6m8s/1/1:P/1:O 6qzl/1/1:B/1:C 6qzl/1/1:D/1:C 6qzl/1/1:E/1:A

[Back to Home]