6mry/3/1:C/1:J

Sequences
>6mry-a3-m1-cC (length=47) [Search sequence]
RQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
>6mry-a3-m1-cJ (length=48) [Search sequence]
ARQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
Structure information
PDB ID 6mry (database links: RCSB PDB PDBe PDBj PDBsum)
Title NoD173 plant defensin
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
PubMed citation 30794440
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C J
UniProt accession A0A4V8H030 A0A4V8H030
Species 200313 (Nicotiana occidentalis) 200313 (Nicotiana occidentalis)
Function annotation BioLiP:6mryJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6mry-a3-m1-cC_6mry-a3-m1-cJ.pdb.gz
Full biological assembly
Download: 6mry-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6mry/1/1:E/1:A 6mry/2/1:B/1:G 6mry/4/1:D/2:L 6mry/5/1:F/1:I 6mry/6/1:H/1:K

[Back to Home]