6mry/3/1:C/1:J

Sequences

>6mry-a3-m1-cC (length=47) [Search sequence]

RQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC

>6mry-a3-m1-cJ (length=48) [Search sequence]

ARQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC

Structure information

PDB ID	6mry (database links: RCSB PDB PDBe PDBj PDBsum)
Title	NoD173 plant defensin
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0
PubMed citation	30794440

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	J
UniProt accession	A0A4V8H030	A0A4V8H030
Species	200313 (Nicotiana occidentalis)	200313 (Nicotiana occidentalis)
Function annotation	BioLiP:6mryJ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6mry-a3-m1-cC_6mry-a3-m1-cJ.pdb.gz

Full biological assembly Download: 6mry-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6mry/1/1:E/1:A 6mry/2/1:B/1:G 6mry/4/1:D/2:L 6mry/5/1:F/1:I 6mry/6/1:H/1:K