6n7m/2/3:D/1:C

Sequences
>6n7m-a2-m3-cD (length=59) [Search sequence]
GVEHYTYEEYAKHIQELKDYAKDPNAVKDVSQKDLEETIKKEQELEKIKTEGLKIKPIT
>6n7m-a2-m1-cC (length=60) [Search sequence]
GVEHYTYEEYAKHIQELKDYAKDPNAVKDVSQKDLEETIKKEQELEKIKTEGLKIKPITI
Structure information
PDB ID 6n7m (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.78 Angstrom Resolution Crystal Structure of Hypothetical Protein CD630_05490 from Clostridioides difficile 630.
Assembly ID 2
Resolution 1.78Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 1
Chain ID D C
UniProt accession Q188Z7 Q188Z7
Species 272563 (Clostridioides difficile 630) 272563 (Clostridioides difficile 630)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6n7m-a2-m3-cD_6n7m-a2-m1-cC.pdb.gz
Full biological assembly
Download: 6n7m-assembly2.cif.gz
Similar dimers

[Back to Home]