6nf3/1/1:A/2:B

Sequences

>6nf3-a1-m1-cA (length=46) [Search sequence]

LDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKL

>6nf3-a1-m2-cB (length=51) [Search sequence]

VSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK

Structure information

PDB ID	6nf3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Monoclinic-3 (Monocln-3) Crystal Form of Human Apolipoprotein C1
Assembly ID	1
Resolution	2.33Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	P02654	P02654
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6nf3-a1-m1-cA_6nf3-a1-m2-cB.pdb.gz

Full biological assembly Download: 6nf3-assembly1.cif.gz