6nf3/1/1:A/2:B

Sequences
>6nf3-a1-m1-cA (length=46) [Search sequence]
LDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKL
>6nf3-a1-m2-cB (length=51) [Search sequence]
VSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK
Structure information
PDB ID 6nf3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the Monoclinic-3 (Monocln-3) Crystal Form of Human Apolipoprotein C1
Assembly ID 1
Resolution 2.33Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P02654 P02654
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6nf3-a1-m1-cA_6nf3-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6nf3-assembly1.cif.gz

[Back to Home]