6nhw/1/1:D/1:F

Sequences
>6nhw-a1-m1-cD (length=36) [Search sequence]
MPGSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLP
>6nhw-a1-m1-cF (length=36) [Search sequence]
MPGSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLP
Structure information
PDB ID 6nhw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the transmembrane domain of the Death Receptor 5 - Dimer of Trimer
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D F
UniProt accession O14763 O14763
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6nhw-a1-m1-cD_6nhw-a1-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6nhw-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6nhy/1/1:B/1:C 6nhy/1/1:A/1:B 6nhy/1/1:A/1:C
  • [Back to Home]