6njy/1/1:A/1:B

Sequences

>6njy-a1-m1-cA (length=237) [Search sequence]

NLYFQSNAMTGYPYPRPQAVKIQVKGHVPYPKNALATVYDIFRDIETVNKAHEAKEAPPF
AIKDFNMNGFAITSYLALPTDTVTERLKTKGFHTVGQPIYLPQNELPPLYGLKGVTIQFR
TPTAFKYNTGYVPEFYGPVFIKSITESYRRIIPGCPEFSTSDILKYIRFTATDLQKGKYR
LTEELMVTGFKGKVYLQFKLSTPPELKLLILYFLEAASICGVGMKKAWGMGDIYITI

>6njy-a1-m1-cB (length=237) [Search sequence]

Structure information

PDB ID	6njy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Type IV CRISPR associated RNA endonuclease Cas6 - apo form
Assembly ID	1
Resolution	1.76Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	80
Sequence identity between the two chains	1.0
PubMed citation	31232162

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	F3ZXK6	F3ZXK6
Species	697281 (Mahella australiensis 50-1 BON)	697281 (Mahella australiensis 50-1 BON)
Function annotation	BioLiP:6njyA	BioLiP:6njyB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6njy-a1-m1-cA_6njy-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6njy-assembly1.cif.gz