6nla/1/1:A/2:A

Sequences
>6nla-a1-m1-cA (length=56) [Search sequence]
MTYKLILNGKTHKGVLTIEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE
>6nla-a1-m2-cA (length=56) [Search sequence]
MTYKLILNGKTHKGVLTIEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE
Structure information
PDB ID 6nla (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of de novo designed metal-controlled dimer of B1 immunoglobulin-binding domain of Streptococcal Protein G (L12H, E15V, T16L, T18I, V29H, Y33H, N37L)-zinc
Assembly ID 1
Resolution 1.34Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
PubMed citation 30938154
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P19909 P19909
Species 1301 (Streptococcus) 1301 (Streptococcus)
Function annotation BioLiP:6nlaA BioLiP:6nlaA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6nla-a1-m1-cA_6nla-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6nla-assembly1.cif.gz

[Back to Home]