6nx5/2/1:C/1:D

Sequences

>6nx5-a2-m1-cC (length=74) [Search sequence]

SMLYVSNLPVGTSSSAIHALFSAYGNVKDIWMLSNSAIVSYESLSSAIVARDALHNRPVF ENHGPVQVMLAKPS

>6nx5-a2-m1-cD (length=75) [Search sequence]

SMLYVSNLPVGTSSSAIHALFSAYGNVKDIWMLSPDNSAIVSYESLSSAIVARDALHNRP VFENHGPVQVMLAKP

Structure information

PDB ID	6nx5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the RRM domain of S. pombe Puf1 in the P21 space group
Assembly ID	2
Resolution	1.554Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	44
Sequence identity between the two chains	0.986

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	O60059	O60059
Species	4896 (Schizosaccharomyces pombe)	4896 (Schizosaccharomyces pombe)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6nx5-a2-m1-cC_6nx5-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6nx5-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6nww/1/1:A/1:B 6nww/2/1:D/1:C 6nx5/1/1:B/1:A