6nx5/2/1:C/1:D

Sequences
>6nx5-a2-m1-cC (length=74) [Search sequence]
SMLYVSNLPVGTSSSAIHALFSAYGNVKDIWMLSNSAIVSYESLSSAIVARDALHNRPVF
ENHGPVQVMLAKPS
>6nx5-a2-m1-cD (length=75) [Search sequence]
SMLYVSNLPVGTSSSAIHALFSAYGNVKDIWMLSPDNSAIVSYESLSSAIVARDALHNRP
VFENHGPVQVMLAKP
Structure information
PDB ID 6nx5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the RRM domain of S. pombe Puf1 in the P21 space group
Assembly ID 2
Resolution 1.554Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 0.986
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession O60059 O60059
Species 4896 (Schizosaccharomyces pombe) 4896 (Schizosaccharomyces pombe)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6nx5-a2-m1-cC_6nx5-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6nx5-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6nww/1/1:A/1:B 6nww/2/1:D/1:C 6nx5/1/1:B/1:A

[Back to Home]