6o35/1/2:D/2:C

Sequences
>6o35-a1-m2-cD (length=99) [Search sequence]
SAEELLRRSREYLKKVKEEQERKAKEFQELLKELSERSEELIRELEEKGAASEAELARMK
QQHMTAYLEAQLTAWEIESKSKIALLELQQNQLNLELRH
>6o35-a1-m2-cC (length=101) [Search sequence]
SSAEELLRRSREYLKKVKEEQERKAKEFQELLKELSERSEELIRELEEKGAASEAELARM
KQQHMTAYLEAQLTAWEIESKSKIALLELQQNQLNLELRHI
Structure information
PDB ID 6o35 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a de novo designed octameric helical-bundle protein
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID D C
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6o35-a1-m2-cD_6o35-a1-m2-cC.pdb.gz
Full biological assembly
Download: 6o35-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6o35/1/1:B/1:A 6o35/1/1:B/1:C 6o35/1/1:D/1:C 6o35/1/1:D/2:A 6o35/1/2:B/2:A 6o35/1/2:B/2:C 6o35/1/2:D/1:A

[Back to Home]