6od3/4/1:J/1:I

Sequences
>6od3-a4-m1-cJ (length=52) [Search sequence]
ERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER
>6od3-a4-m1-cI (length=59) [Search sequence]
RMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER
Structure information
PDB ID 6od3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human TCF4 C-terminal bHLH domain in Complex with 13-bp Oligonucleotide Containing E-box Sequence
Assembly ID 4
Resolution 1.494Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 73
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID J I
UniProt accession P15884 P15884
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6od3-a4-m1-cJ_6od3-a4-m1-cI.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6od3-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6od5/1/1:B/1:A 6od3/1/1:B/1:A 6od3/2/1:F/1:E 6od4/1/1:A/1:B 6od4/2/1:G/1:H 6od5/2/1:C/1:D
    		•

    [Back to Home]