6od5/1/1:B/1:A

Sequences
>6od5-a1-m1-cB (length=60) [Search sequence]
MRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRE
>6od5-a1-m1-cA (length=62) [Search sequence]
HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVR
ER
Structure information
PDB ID 6od5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human TCF4 C-terminal bHLH domain in Complex with 12-bp Oligonucleotide Containing E-box Sequence with 5-carboxylcytosines
Assembly ID 1
Resolution 2.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 1.0
PubMed citation 31081034
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P15884 P15884
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6od5B BioLiP:6od5A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6od5-a1-m1-cB_6od5-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6od5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6od3/1/1:B/1:A 6od3/2/1:F/1:E 6od4/1/1:A/1:B 6od4/2/1:G/1:H 6od5/2/1:C/1:D
Other dimers with similar sequences but different poses
  • 6od3/4/1:J/1:I 6od3/3/1:G/1:H
  • [Back to Home]