6ogt/1/1:A/2:A

Sequences
>6ogt-a1-m1-cA (length=99) [Search sequence]
PQITLWQRPIVTIKVGGQLREALIDTGADDTIFEEINLPGRWKPKLIGGIGGFMKVRQYD
QIPIEICGHQAIGTVLVGPTPINVIGRNMLTQIGCTLNF
>6ogt-a1-m2-cA (length=99) [Search sequence]
PQITLWQRPIVTIKVGGQLREALIDTGADDTIFEEINLPGRWKPKLIGGIGGFMKVRQYD
QIPIEICGHQAIGTVLVGPTPINVIGRNMLTQIGCTLNF
Structure information
PDB ID 6ogt (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of darunavir-resistant HIV-1 protease (P51) in complex with GRL-001
Assembly ID 1
Resolution 1.21Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 149
Sequence identity between the two chains 1.0
PubMed citation 32606378
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O38893 O38893
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
Function annotation BioLiP:6ogtA BioLiP:6ogtA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6ogt-a1-m1-cA_6ogt-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6ogt-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4npt/1/1:A/2:A 4npu/1/1:A/1:B 6mk9/1/1:A/1:B 6mkl/1/1:A/1:B 6ogl/1/1:A/2:A 6ogq/1/1:A/2:A 6ogr/1/1:A/2:A 6ogs/1/1:A/2:A 6ogv/1/1:A/2:A

[Back to Home]