6oqa/2/1:H/1:G

Sequences
>6oqa-a2-m1-cH (length=85) [Search sequence]
LEPRLQRELERLQAALRQTEAREIEWREKAQDLALSLAQTKASVSSLQEVAMFLQASVLE
RDSEQQRLQDELELTRRALEKERLH
>6oqa-a2-m1-cG (length=87) [Search sequence]
DSLEPRLQRELERLQAALRQTEAREIEWREKAQDLALSLAQTKASVSSLQEVAMFLQASV
LERDSEQQRLQDELELTRRALEKERLH
Structure information
PDB ID 6oqa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of CEP250 bound to FKBP12 in the presence of FK506-like novel natural product
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 119
Sequence identity between the two chains 1.0
PubMed citation 32606248
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession Q9BV73 Q9BV73
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6oqaH BioLiP:6oqaG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6oqa-a2-m1-cH_6oqa-a2-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6oqa-assembly2.cif.gz
Similar dimers

[Back to Home]