6p20/1/1:B/1:C

Sequences
>6p20-a1-m1-cB (length=109) [Search sequence]
SGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTV
DWDVGGDWTEKMASMSSKSSGTHIQEAGGTMTHKAGGNMLFTAPRYDFT
>6p20-a1-m1-cC (length=109) [Search sequence]
SGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTV
DWDVGGDWTEKMASMSSKSSGTHIQEAGGTMTHKAGGNMLFTAPRYDFT
Structure information
PDB ID 6p20 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with a T4 gp5 beta-helix fragment modified to mimic the phiKZ central spike gp164
Assembly ID 1
Resolution 1.749Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 388
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession Q8SCZ8 Q8SCZ8
Species 169683 (Phikzvirus phiKZ) 169683 (Phikzvirus phiKZ)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6p20-a1-m1-cB_6p20-a1-m1-cC.pdb.gz
Full biological assembly
Download: 6p20-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6p20/1/1:B/1:A 6p20/1/1:C/1:A

[Back to Home]