6pcf/1/2:C/2:B

Sequences
>6pcf-a1-m2-cC (length=56) [Search sequence]
QVCCGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKF
>6pcf-a1-m2-cB (length=65) [Search sequence]
APSMKERQVCCGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK
EKFEA
Structure information
PDB ID 6pcf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human Coa6: W59C mutant protein
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID C B
UniProt accession Q5JTJ3 Q5JTJ3
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6pcf-a1-m2-cC_6pcf-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6pcf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6pcf/1/2:C/1:D 6pcf/1/1:A/2:B
  • [Back to Home]