6pfl/1/2:A/2:B

Sequences
>6pfl-a1-m2-cA (length=76) [Search sequence]
NSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEET
GNRRPVMLTLLRVPRL
>6pfl-a1-m2-cB (length=77) [Search sequence]
NSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEET
GNRRPVMLTLLRVPRLN
Structure information
PDB ID 6pfl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Human HUWE1 WWE domain in complex with ADPR
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q7Z6Z7 Q7Z6Z7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6pflA BioLiP:6pflB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6pfl-a1-m2-cA_6pfl-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6pfl-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6pfl/1/1:B/2:B 6pfl/1/1:A/2:A
  • 6pfl/1/1:A/2:B 6pfl/1/2:A/1:B
  • [Back to Home]