6pse/1/1:B/1:A

Sequences

>6pse-a1-m1-cB (length=66) [Search sequence]

LVEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRS EEQLKE

>6pse-a1-m1-cA (length=76) [Search sequence]

PSEEEEYARLVEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEEL EVDYEAIRSEEQLKEA

Structure information

PDB ID	6pse (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex of BICD2 with a Dynein Light Intermediate Chain Peptide
Assembly ID	1
Resolution	2.404Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0
PubMed citation	33173051

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q8TD16	Q8TD16
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6pseB	BioLiP:6pseA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6pse-a1-m1-cB_6pse-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6pse-assembly1.cif.gz