6ptg/1/1:A/1:B

Sequences

>6ptg-a1-m1-cA (length=85) [Search sequence]

MPLTDEEIANFKTRLLEMKAKLSHTTTKEYKLLRQIDRALEKIEEASYGICDVSGEEIPL ARLMAIPYATMTVKSQEKFEKGLLS

>6ptg-a1-m1-cB (length=86) [Search sequence]

PLTDEEIANFKTRLLEMKAKLSHTLTTKEYKLLRQIDRALEKIEEASYGICDVSGEEIPL ARLMAIPYATMTVKSQEKFEKGLLSG

Structure information

PDB ID	6ptg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of RNA polymerase binding protein and transcriptional regulator Dks from Chlamydia trachomatis L2 (LGV434)
Assembly ID	1
Resolution	2.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	29
Sequence identity between the two chains	0.988

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O84412	O84412
Species	813 (Chlamydia trachomatis)	813 (Chlamydia trachomatis)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6ptg-a1-m1-cA_6ptg-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6ptg-assembly1.cif.gz