6pvr/1/1:C/1:D

Sequences
>6pvr-a1-m1-cC (length=33) [Search sequence]
MFEPFQILSICSFILSALHFMAWTIGHLNQIKR
>6pvr-a1-m1-cD (length=33) [Search sequence]
MFEPFQILSICSFILSALHFMAWTIGHLNQIKR
Structure information
PDB ID 6pvr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Influenza B M2 Proton Channel in the Closed State - SSNMR Structure at pH 7.5
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLID-STATE NMR
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession
Species 1601064 (Influenza B virus (B/Maryland/1/2001)) 1601064 (Influenza B virus (B/Maryland/1/2001))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6pvr-a1-m1-cC_6pvr-a1-m1-cD.pdb.gz
Full biological assembly
Download: 6pvr-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6pvr/1/1:A/1:B 6pvr/1/1:A/1:D 6pvr/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 2kix/1/1:C/1:D 2kix/1/1:A/1:B 2kix/1/1:A/1:D 2kix/1/1:B/1:C
  • [Back to Home]