6pxz/1/1:A/1:C

Sequences
>6pxz-a1-m1-cA (length=99) [Search sequence]
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDA
REAVQKFTGDSRADQFANEWGRSGKDPNHFRPAGLPKRY
>6pxz-a1-m1-cC (length=103) [Search sequence]
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDA
REAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Structure information
PDB ID 6pxz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of mouse Serum Amyloid A3 (SAA3) in the trimeric form
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 31484771
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P04918 P04918
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:6pxzA BioLiP:6pxzC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6pxz-a1-m1-cA_6pxz-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6pxz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4q5g/1/2:A/2:B 4q5g/1/1:A/1:B 6pxz/1/1:A/1:B 6py0/1/1:B/1:A
  • 4q5g/1/1:A/2:B 4q5g/1/1:B/2:A
  • 6pxz/1/1:B/1:C 6py0/1/1:C/1:B
  • [Back to Home]