6pxz/1/1:B/1:C

Sequences

>6pxz-a1-m1-cB (length=103) [Search sequence]

RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDA REAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

>6pxz-a1-m1-cC (length=103) [Search sequence]

RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDA REAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Structure information

PDB ID	6pxz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of mouse Serum Amyloid A3 (SAA3) in the trimeric form
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	17
Sequence identity between the two chains	1.0
PubMed citation	31484771

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P04918	P04918
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:6pxzC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6pxz-a1-m1-cB_6pxz-a1-m1-cC.pdb.gz

Full biological assembly Download: 6pxz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4q5g/1/2:A/2:B 4q5g/1/1:A/1:B 6pxz/1/1:A/1:B 6py0/1/1:B/1:A 4q5g/1/1:A/2:B 4q5g/1/1:B/2:A 6pxz/1/1:A/1:C 6py0/1/1:C/1:A