6q16/1/1:6/1:7

Sequences
>6q16-a1-m1-c6 (length=53) [Search sequence]
MDDLVFAGNKALYLVLILSGWPTIVATCLFLLSGWYGEVLLSYGRQVIFLALA
>6q16-a1-m1-c7 (length=84) [Search sequence]
MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCL
FLLSGWYGEVLLSYGRQVIFLALA
Structure information
PDB ID 6q16 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Focussed refinement of InvGN0N1:PrgHK:SpaPQR:PrgIJ from Salmonella SPI-1 injectisome NC-base
Assembly ID 1
Resolution 4.1Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 6 7
UniProt accession P0A1L7 P0A1L7
Species 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6q16-a1-m1-c6_6q16-a1-m1-c7.pdb.gz
Full biological assembly
Download: 6q16-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6pem/1/1:6/1:7 6pep/1/1:6/1:7 6q14/1/1:6/1:7 6q15/1/1:6/1:7

[Back to Home]