6q16/1/1:AM/1:AR

Sequences
>6q16-a1-m1-cAM (length=39) [Search sequence]
DPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
>6q16-a1-m1-cAR (length=88) [Search sequence]
GQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEM
ISDYNLYVSMVSTLTRKGVGAVETLLRS
Structure information
PDB ID 6q16 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Focussed refinement of InvGN0N1:PrgHK:SpaPQR:PrgIJ from Salmonella SPI-1 injectisome NC-base
Assembly ID 1
Resolution 4.1Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID AM AR
UniProt accession P41785 P41785
Species 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6q16-a1-m1-cAM_6q16-a1-m1-cAR.pdb.gz
Full biological assembly
Download: 6q16-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6pep/1/1:AM/1:AR 6q15/1/1:AM/1:AR 7ah9/1/1:1K/1:1P 7ahi/1/1:1K/1:1P
Other dimers with similar sequences but different poses
  • 7ahi/1/1:1K/1:1L 7ah9/1/1:1K/1:1L
  • [Back to Home]