6q40/2/1:D/1:C

Sequences
>6q40-a2-m1-cD (length=78) [Search sequence]
RNPITITPQFDCGATNSQQYVARSGDTLTKIAQEIYHDVVGVCDIARANNLADPNRIDAG
TPYTIPINCQTYDRNSCL
>6q40-a2-m1-cC (length=79) [Search sequence]
ARNPITITPQFDCGATNSQQYVARSGDTLTKIAQEIYHDVVGVCDIARANNLADPNRIDA
GTPYTIPINCQTYDRNSCL
Structure information
PDB ID 6q40 (database links: RCSB PDB PDBe PDBj PDBsum)
Title A secreted LysM effector of the wheat pathogen Zymoseptoria tritici protects the fungal hyphae against chitinase hydrolysis through ligand-dependent polymerisation of LysM homodimers
Assembly ID 2
Resolution 2.412Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession F9XHX3 F9XHX3
Species 336722 (Zymoseptoria tritici IPO323) 336722 (Zymoseptoria tritici IPO323)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6q40-a2-m1-cD_6q40-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6q40-assembly2.cif.gz
Similar dimers

[Back to Home]