6q43/1/1:C/1:A

Sequences
>6q43-a1-m1-cC (length=43) [Search sequence]
GPPGPKGPKGDPGDPGPPGARGQAGVGFGPPGPKGPKGDPGDP
>6q43-a1-m1-cA (length=44) [Search sequence]
GPPGPKGPKGDPGDPGPPGARGQAGVGFGPPGPKGPKGDPGDPG
Structure information
PDB ID 6q43 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Atomic resolution crystal structure of an ABA collagen heterotrimer
Assembly ID 1
Resolution 1.16Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 125
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6q43-a1-m1-cC_6q43-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6q43-assembly1.cif.gz

[Back to Home]