6q53/1/1:A/1:D

Sequences
>6q53-a1-m1-cA (length=54) [Search sequence]
YRPSRPSNPRDDWKLWLVVNPGTWLIPLLITFLATALIVHSFVFTHEAYNPLTY
>6q53-a1-m1-cD (length=57) [Search sequence]
MSEYRPSRPSNPRDDWKLWLVVNPGTWLIPLLITFLATALIVHSFVFTHEAYNPLTY
Structure information
PDB ID 6q53 (database links: RCSB PDB PDBe PDBj PDBsum)
Title CRYSTAL STRUCTURE OF THE LIGHT-HARVESTING COMPLEX II (B800-850) FROM Ectothiorhodospira haloalkaliphila
Assembly ID 1
Resolution 3.701Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation 30543422
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A D
UniProt accession
Species 421628 (Ectothiorhodospira haloalkaliphila) 421628 (Ectothiorhodospira haloalkaliphila)
Function annotation BioLiP:6q53A BioLiP:6q53D
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6q53-a1-m1-cA_6q53-a1-m1-cD.pdb.gz
Full biological assembly
Download: 6q53-assembly1.cif.gz

[Back to Home]