6q68/1/1:B/1:D

Sequences
>6q68-a1-m1-cB (length=42) [Search sequence]
PAPPAIADLLASVDSEEVRDYCRTKGWIVQEKITKESLERNV
>6q68-a1-m1-cD (length=42) [Search sequence]
PAPPAIADLLASVDSEEVRDYCRTKGWIVQEKITKESLERNV
Structure information
PDB ID 6q68 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of bovine ACBD3 GOLD domain in complex with 3A protein of enterovirus-F2 (fusion protein)
Assembly ID 1
Resolution 3.161Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q2LKY9 Q2LKY9
Species 1330520 (Enterovirus F) 1330520 (Enterovirus F)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6q68-a1-m1-cB_6q68-a1-m1-cD.pdb.gz
Full biological assembly
Download: 6q68-assembly1.cif.gz

[Back to Home]