6q69/1/1:B/1:D

Sequences

>6q69-a1-m1-cB (length=43) [Search sequence]

IPAPPAIADLLASVDSEEVREYCKKKGWIVEVPVTATTLERNV

>6q69-a1-m1-cD (length=43) [Search sequence]

IPAPPAIADLLASVDSEEVREYCKKKGWIVEVPVTATTLERNV

Structure information

PDB ID	6q69 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of porcine ACBD3 GOLD domain in complex with 3A protein of enterovirus-G1
Assembly ID	1
Resolution	2.747Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	20
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	O41174	O41174
Species	64141 (Porcine enterovirus 9)	64141 (Porcine enterovirus 9)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6q69-a1-m1-cB_6q69-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6q69-assembly1.cif.gz