6r0x/1/1:F/1:E

Sequences
>6r0x-a1-m1-cF (length=98) [Search sequence]
PGASLDGRPGDRVDLSCGGVRWVWAPSFPACKGLSKGRRPILWAAAAGAPTVPPLQPFVG
RIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRT
>6r0x-a1-m1-cE (length=99) [Search sequence]
GASLDGRPGDRVDLSCGGVRWVWAPSFPACKGLSKGRRPILWAAAAGAPTVPPLQPFVGR
IRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYC
Structure information
PDB ID 6r0x (database links: RCSB PDB PDBe PDBj PDBsum)
Title The extracellular domain of G6b-B in complex with Fab fragment and DP12 heparin oligosaccharide.
Assembly ID 1
Resolution 3.13Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 33
Sequence identity between the two chains 0.99
PubMed citation 31436532
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession O95866 O95866
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6r0xF BioLiP:6r0xE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6r0x-a1-m1-cF_6r0x-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6r0x-assembly1.cif.gz

[Back to Home]