6rwy/1/1:c/1:d

Sequences

>6rwy-a1-m1-cc (length=208) [Search sequence]

SLIATLSFFTLLPFLVAAGTCYIKFSIVFVMVRNALGLQQVPSNMTLNGIALIMALFVMK
PIIEAGYENYLNGPQKFDTISDIVRFSDSGLMEYKQYLKKHTDLELARFFQRSEEENADL
KSAENNDYSLFSLLPAYALSEIKDAFKIGFYLYLPFVVVDLVISSILLALGMMMMSPITI
SVPIKLVLFVALDGWGILSKALIEQYIN

>6rwy-a1-m1-cd (length=208) [Search sequence]

Structure information

PDB ID	6rwy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Export apparatus core and inner rod of the Shigella type 3 secretion system
Assembly ID	1
Resolution	5.11Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	112
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	c	d
UniProt accession	P0A1L3	P0A1L3
Species	623 (Shigella flexneri)	623 (Shigella flexneri)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6rwy-a1-m1-cc_6rwy-a1-m1-cd.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6rwy-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6r6b/1/1:B/1:A 6rwy/1/1:a/1:b 6rwy/1/1:b/1:c 6rwy/1/1:d/1:e