6s9r/1/2:A/2:B

Sequences
>6s9r-a1-m2-cA (length=60) [Search sequence]
AQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCAA
>6s9r-a1-m2-cB (length=61) [Search sequence]
DAQAREKLALYVYEYLLHVGAQKAAQTFLSEIRWEKNITLGEPPGFLHTWWCVFWDLYCA
A
Structure information
PDB ID 6s9r (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SSDP from D. melanogaster
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9VEB9 Q9VEB9
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6s9r-a1-m2-cA_6s9r-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6s9r-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6iwv/1/1:B/1:A 6iwv/1/2:B/2:A 6s9r/1/1:A/1:B 6tyd/1/1:B/1:A

[Back to Home]