6scf/2/1:G/1:B

Sequences
>6scf-a2-m1-cG (length=112) [Search sequence]
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTT
FQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIV
>6scf-a2-m1-cB (length=113) [Search sequence]
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQLINSLCGTT
FQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYESGKVQFFEIIVD
Structure information
PDB ID 6scf (database links: RCSB PDB PDBe PDBj PDBsum)
Title A viral anti-CRISPR subverts type III CRISPR immunity by rapid degradation of cyclic oligoadenylate
Assembly ID 2
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 86
Sequence identity between the two chains 1.0
PubMed citation 31942067
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G B
UniProt accession Q8QL27 Q8QL27
Species 157898 (Sulfolobus islandicus rod-shaped virus 1) 157898 (Sulfolobus islandicus rod-shaped virus 1)
Function annotation BioLiP:6scfG BioLiP:6scfB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6scf-a2-m1-cG_6scf-a2-m1-cB.pdb.gz
Full biological assembly
Download: 6scf-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2x4i/2/1:B/1:A 6scf/1/2:H/1:A 6scf/3/1:C/1:E 6scf/4/1:D/1:F

[Back to Home]