6sf3/1/1:B/2:B

Sequences
>6sf3-a1-m1-cB (length=104) [Search sequence]
NYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKN
SQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
>6sf3-a1-m2-cB (length=104) [Search sequence]
NYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKN
SQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR
Structure information
PDB ID 6sf3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bone morphogenetic protein 10 (BMP10) in complex with extracellular domain of activin receptor-like kinase 1 (ALK1) at 2.3 Angstrom
Assembly ID 1
Resolution 2.30001Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession O95393 O95393
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6sf3-a1-m1-cB_6sf3-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6sf3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6sf1/1/1:B/2:B 7poi/1/1:A/1:B 7poj/1/1:A/1:B 7ppa/1/1:A/1:B 7ppb/1/1:A/2:A 7ppc/1/1:A/1:B 7ppc/2/1:C/1:D

[Back to Home]