6si6/1/1:A/1:B

Sequences
>6si6-a1-m1-cA (length=47) [Search sequence]
PSSQEKIATIHEYLLEHKELEEAMFSLISQGRGRSLINMVVKSALNI
>6si6-a1-m1-cB (length=51) [Search sequence]
TIPSSQEKIATIHEYLLEHKELEEAMFSLISQGRGRSLINMVVKSALNIET
Structure information
PDB ID 6si6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title N-terminal domain of Drosophila X virus VP3
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q96724 Q96724
Species 654931 (Drosophila x virus (isolate Chung)) 654931 (Drosophila x virus (isolate Chung))
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6si6-a1-m1-cA_6si6-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6si6-assembly1.cif.gz
Similar dimers

[Back to Home]