6sif/1/1:D/1:F

Sequences
>6sif-a1-m1-cD (length=50) [Search sequence]
MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLW
>6sif-a1-m1-cF (length=51) [Search sequence]
MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA
Structure information
PDB ID 6sif (database links: RCSB PDB PDBe PDBj PDBsum)
Title Epidermicin antimicrobial protein from Staphylococcus epidermidis
Assembly ID 1
Resolution 1.69Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D F
UniProt accession H9BG66 H9BG66
Species 1282 (Staphylococcus epidermidis) 1282 (Staphylococcus epidermidis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6sif-a1-m1-cD_6sif-a1-m1-cF.pdb.gz
Full biological assembly
Download: 6sif-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6sif/1/1:B/1:F 6sif/1/1:E/1:A
  • 6sif/1/1:E/1:H 6sif/1/1:G/1:A
  • [Back to Home]