6sif/1/1:G/1:B

Sequences
>6sif-a1-m1-cG (length=47) [Search sequence]
AAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKK
>6sif-a1-m1-cB (length=51) [Search sequence]
MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA
Structure information
PDB ID 6sif (database links: RCSB PDB PDBe PDBj PDBsum)
Title Epidermicin antimicrobial protein from Staphylococcus epidermidis
Assembly ID 1
Resolution 1.69Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G B
UniProt accession H9BG66 H9BG66
Species 1282 (Staphylococcus epidermidis) 1282 (Staphylococcus epidermidis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6sif-a1-m1-cG_6sif-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6sif-assembly1.cif.gz

[Back to Home]