6sq2/1/1:D/1:E

Sequences
>6sq2-a1-m1-cD (length=31) [Search sequence]
NRPRFTLQELRDVLQERNKLKSQLLVVQEEL
>6sq2-a1-m1-cE (length=32) [Search sequence]
NRPRFTLQELRDVLQERNKLKSQLLVVQEELQ
Structure information
PDB ID 6sq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a phosphomimetic switch 2 variant of Rab8a in complex with the phospho-Rab binding domain of RILPL2
Assembly ID 1
Resolution 1.684Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession Q969X0 Q969X0
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6sq2-a1-m1-cD_6sq2-a1-m1-cE.pdb.gz
Full biological assembly
Download: 6sq2-assembly1.cif.gz
Similar dimers

[Back to Home]