6ste/1/1:A/1:B

Sequences
>6ste-a1-m1-cA (length=81) [Search sequence]
DYTAYAPLTCYFTNSTLGLLAPPNCSVLCNSTTTWFNETSPNNASCLLTVDFLTQNQPYN
CSVGHCDNGTCAGPPRHAQCW
>6ste-a1-m1-cB (length=87) [Search sequence]
DYTAYAPLTCYFTNSTLGLLAPPNCSVLCNSTTTWFNETSPNNASCLLTVDFLTQDAILQ
ENQPYNCSVGHCDNGTCAGPPRHAQCW
Structure information
PDB ID 6ste (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the tick chemokine-binding protein Evasin-4 (SG 3)
Assembly ID 1
Resolution 1.79Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 56
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0C8E9 P0C8E9
Species 34632 (Rhipicephalus sanguineus) 34632 (Rhipicephalus sanguineus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6ste-a1-m1-cA_6ste-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6ste-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6st4/1/1:A/2:A 6stc/1/1:A/2:A

[Back to Home]