6sws/3/2:E/1:D

Sequences
>6sws-a3-m2-cE (length=97) [Search sequence]
AMVVQPDRIRCGAETTVYVIVRCKLDDRVATEAEFSPEDSPSVRMEAKVENEYTISVKAP
NLSSGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLS
>6sws-a3-m1-cD (length=112) [Search sequence]
SNAMVVQPDRIRCGAETTVYVIVRCKLDDRVATEAEFSPEDSPSVRMEAKVENEYTISVK
APNLSSGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLSNAANPVEFMCQAF
Structure information
PDB ID 6sws (database links: RCSB PDB PDBe PDBj PDBsum)
Title The DBB dimerization domain of B-cell adaptor for PI3K (BCAP) is required for down regulation of inflammatory signalling through the Toll-like receptor pathway
Assembly ID 3
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID E D
UniProt accession Q6ZUJ8 Q6ZUJ8
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6sws-a3-m2-cE_6sws-a3-m1-cD.pdb.gz
Full biological assembly
Download: 6sws-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6sws/1/1:B/1:A 6sws/2/1:C/3:C

[Back to Home]