6sx0/1/1:A/1:B

Sequences
>6sx0-a1-m1-cA (length=70) [Search sequence]
DSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEG
KKIVEDILKS
>6sx0-a1-m1-cB (length=71) [Search sequence]
SDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATME
GKKIVEDILKS
Structure information
PDB ID 6sx0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Specific dsRNA recognition by wild type H7N1 NS1 RNA-binding domain
Assembly ID 1
Resolution 1.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 73
Sequence identity between the two chains 1.0
PubMed citation 32867106
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q1PST0 Q1PST0
Species 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1))) 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1)))
Function annotation BioLiP:6sx0A BioLiP:6sx0B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6sx0-a1-m1-cA_6sx0-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6sx0-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6sw8/1/1:A/1:B 6sx2/1/1:A/1:B 6zlc/1/1:B/1:A

[Back to Home]