6t7o/1/1:B/1:A

Sequences
>6t7o-a1-m1-cB (length=58) [Search sequence]
MIEIIRSKEFSLKPMDSEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTS
>6t7o-a1-m1-cA (length=59) [Search sequence]
MIEIIRSKEFSLKPMDSEEAVLQMNLLGHDFFVFTDRETDGTSIVYRRKDGKYGLIQTS
Structure information
PDB ID 6t7o (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray structure of the C-terminal domain of S. aureus Hibernating Promoting Factor (CTD-SaHPF)
Assembly ID 1
Resolution 1.60004Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q2G055 Q2G055
Species 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6t7o-a1-m1-cB_6t7o-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6t7o-assembly1.cif.gz
Similar dimers

[Back to Home]