6tbp/1/1:B/1:A

Sequences
>6tbp-a1-m1-cB (length=171) [Search sequence]
PTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSIAIHRAGEFTLFRFSK
KIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLL
TGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKSGNTVVCAVQA
>6tbp-a1-m1-cA (length=172) [Search sequence]
APPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSIAIHRAGEFTLFRF
SKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGM
LLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKSGNTVVCAVQ
Structure information
PDB ID 6tbp (database links: RCSB PDB PDBe PDBj PDBsum)
Title 3C-like protease from Southampton virus complexed with FMOPL000490a.
Assembly ID 1
Resolution 1.56Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 61
Sequence identity between the two chains 0.994
PubMed citation 32743543
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q04544 Q04544
Species 37129 (Southampton virus (serotype 3)) 37129 (Southampton virus (serotype 3))
Function annotation BioLiP:6tbpA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6tbp-a1-m1-cB_6tbp-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6tbp-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wqs/1/1:A/1:D 1wqs/1/1:B/1:C 2iph/1/1:B/1:A 6t1q/1/1:B/1:A 6t1q/1/2:B/2:A 6t1q/2/1:B/1:A 6t2i/1/1:A/1:B 6t2x/1/1:A/1:B 6t3g/1/1:B/1:A 6t49/1/1:B/1:A 6t4e/1/1:A/1:B 6t4s/1/1:B/1:A 6t4s/1/2:B/2:A 6t5d/1/1:A/1:B 6t5r/1/1:A/1:B 6t6w/1/1:B/1:A 6t71/1/1:B/1:A 6t82/1/1:B/1:A 6t8r/1/1:B/1:A 6t8t/1/1:B/1:A 6tal/1/1:B/1:A 6taw/1/1:B/1:A 6tbo/1/1:A/1:B 6tc1/1/1:A/1:B 6tcf/1/1:B/1:A 6tgl/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 6t1q/1/2:B/1:A 1wqs/1/1:A/1:B 1wqs/1/1:C/1:D 6t1q/1/1:B/2:A 6t4s/1/1:B/2:A 6t4s/1/2:B/1:A
  • [Back to Home]