6tcb/1/1:A/1:B

Sequences
>6tcb-a1-m1-cA (length=94) [Search sequence]
GHMDELFEEHLEIAKALFAQRLPYWCDVFLRPADQAFNAYLNARGQASTYLVLEGFDPVY
VPRGCDLDAVRATARARARLREAGLGEDALPVLL
>6tcb-a1-m1-cB (length=94) [Search sequence]
GHMDELFEEHLEIAKALFAQRLPYWCDVFLRPADQAFNAYLNARGQASTYLVLEGFDPVY
VPRGCDLDAVRATARARARLREAGLGEDALPVLL
Structure information
PDB ID 6tcb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of protein PA2723 from Pseudomonas aeruginosa PAO1
Assembly ID 1
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9I0B9 Q9I0B9
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
Function annotation BioLiP:6tcbB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6tcb-a1-m1-cA_6tcb-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6tcb-assembly1.cif.gz

[Back to Home]