6tdd/1/1:A/1:B

Sequences
>6tdd-a1-m1-cA (length=45) [Search sequence]
GPGSMNKPTSSDGWKDDYLSRLSRLSKNQLMALALKLKQQQLEQG
>6tdd-a1-m1-cB (length=45) [Search sequence]
GPGSMNKPTSSDGWKDDYLSRLSRLSKNQLMALALKLKQQQLEQG
Structure information
PDB ID 6tdd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bam_5924 docking domain
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 49
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q0B304 Q0B304
Species 339670 (Burkholderia ambifaria AMMD) 339670 (Burkholderia ambifaria AMMD)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6tdd-a1-m1-cA_6tdd-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6tdd-assembly1.cif.gz

[Back to Home]