6thh/1/2:A/2:B

Sequences
>6thh-a1-m2-cA (length=96) [Search sequence]
MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETF
EWWEFENQYLEFELDYYVKDEKIFVLEMHFWRKIRK
>6thh-a1-m2-cB (length=96) [Search sequence]
MNYKELEKMLDVIFENSEIKEIDLFFDPEVEISKQEFEDLVKNADPLQKVVGDNYITETF
EWWEFENQYLEFELDYYVKDEKIFVLEMHFWRKIRK
Structure information
PDB ID 6thh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of type I-D CRISPR-Cas nuclease Cas10d in complex with the SIRV3 AcrID1 (gp02) anti-CRISPR protein
Assembly ID 1
Resolution 3.48Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 59
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession A0A1B3SN05 A0A1B3SN05
Species 1895333 (Sulfolobus islandicus rudivirus 3) 1895333 (Sulfolobus islandicus rudivirus 3)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6thh-a1-m2-cA_6thh-a1-m2-cB.pdb.gz
Full biological assembly
Download: 6thh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6exp/1/1:A/1:B 6exp/2/1:C/1:D 6exp/3/1:E/1:F 6thh/1/1:A/1:B

[Back to Home]