6tub/1/1:E/1:F

Sequences
>6tub-a1-m1-cE (length=31) [Search sequence]
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
>6tub-a1-m1-cF (length=31) [Search sequence]
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Structure information
PDB ID 6tub (database links: RCSB PDB PDBe PDBj PDBsum)
Title Beta-endorphin amyloid fibril
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLID-STATE NMR
Number of inter-chain contacts 111
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession P01189 P01189
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6tub-a1-m1-cE_6tub-a1-m1-cF.pdb.gz
Full biological assembly
Download: 6tub-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6tub/1/1:A/1:B 6tub/1/1:B/1:C 6tub/1/1:C/1:D 6tub/1/1:D/1:E
Other dimers with similar sequences but different poses
  • 6tub/1/1:D/1:F 6tub/1/1:A/1:C 6tub/1/1:B/1:D
  • [Back to Home]