6uag/1/1:B/1:A

Sequences
>6uag-a1-m1-cB (length=91) [Search sequence]
DYIPEPDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDDIHKKHPCLVPY
DELPEEEKEADRNTANTIKVKKLGFRIEKED
>6uag-a1-m1-cA (length=94) [Search sequence]
NKLDYIPEPDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDDIHKKHPCL
VPYDELPEEEKEADRNTANTIKVKKLGFRIEKED
Structure information
PDB ID 6uag (database links: RCSB PDB PDBe PDBj PDBsum)
Title Closed Dimer of Y77A Mutant Putative Ryanodine Receptor from Bacteroides thetaiotaomicron VPI-5482
Assembly ID 1
Resolution 2.709Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q8A5J2 Q8A5J2
Species 226186 (Bacteroides thetaiotaomicron VPI-5482) 226186 (Bacteroides thetaiotaomicron VPI-5482)
Function annotation BioLiP:6uagB BioLiP:6uagA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6uag-a1-m1-cB_6uag-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6uag-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3nrt/1/1:A/1:B 3nrt/2/1:D/1:C 3nrt/3/1:F/1:E 4n05/1/1:B/1:A 4n05/2/1:D/1:C 4n05/3/1:F/1:E 6uag/2/1:C/1:D 6uag/3/1:E/1:F 6uam/1/1:A/1:B 6uam/2/1:C/1:D 6uam/3/1:F/1:E 6ug4/1/1:A/1:B 6ug4/2/1:C/1:D 6ug4/3/1:F/1:E 6ug5/1/1:A/1:C 6ug5/2/1:I/1:E 6ug5/3/1:K/1:G

[Back to Home]