6uph/1/1:A/1:E

Sequences
>6uph-a1-m1-cA (length=93) [Search sequence]
ELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLV
GLLEHTNLLALHAKRITIMKKDMQLARRIRGQF
>6uph-a1-m1-cE (length=97) [Search sequence]
TPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEA
YLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
Structure information
PDB ID 6uph (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of a Yeast Centromeric Nucleosome at 2.7 Angstrom resolution
Assembly ID 1
Resolution 2.7Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 32004465
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A E
UniProt accession P36012 P36012
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
Function annotation BioLiP:6uphA BioLiP:6uphE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6uph-a1-m1-cA_6uph-a1-m1-cE.pdb.gz
Full biological assembly
Download: 6uph-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6qld/1/1:a/1:e 7k78/1/1:A/1:E 7on1/1/1:a/1:e

[Back to Home]