6ut2/1/1:B/1:C

Sequences
>6ut2-a1-m1-cB (length=33) [Search sequence]
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER
>6ut2-a1-m1-cC (length=33) [Search sequence]
GMDAIKKKMQMLKLDNYHLENEVARLKKLVGER
Structure information
PDB ID 6ut2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title 3D structure of the leiomodin/tropomyosin binding interface
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6ut2-a1-m1-cB_6ut2-a1-m1-cC.pdb.gz
Full biological assembly
Download: 6ut2-assembly1.cif.gz

[Back to Home]